TLR5 anticorps (AA 151-181)

N° du produit ABIN2376359

L’anticorps Chèvre Polyclonal anti-TLR5 a été validé pour IHC et ELISA. Il convient pour détecter TLR5 dans des échantillons de Humain.

Aperçu rapide pour TLR5 anticorps (AA 151-181) (ABIN2376359)

Antigène: TLR5 (Toll-Like Receptor 5 (TLR5))

Reactivité: Humain

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp TLR5 est non-conjugé

Application: Immunohistochemistry (IHC), ELISA

Détail du produit anti-TLR5 anticorps

Épitope: AA 151-181

Séquence: DLSKNQIRSL YLHPSFGKLN SLKSIDFSSN Q

Réactivité croisée: Humain

Réactivité croisée (Details): Calculated cross reactivity: Hu

Attributs du produit: TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3)

Purification: Purified by immunoaffinity chromatography.

Immunogène: Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5.

Isotype: IgG

Information d'application

Indications d'application: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 1 mg/mL BSA, 0.09 % sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: 4°C (-20°C Glycerol)

Détails sur TLR5

Antigène: TLR5 (Toll-Like Receptor 5 (TLR5))

Autre désignation: TLR5

Pathways: Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades